PDB entry 1sul

View 1sul on RCSB PDB site
Description: crystal structure of the apo-ysxc
Deposited on 2004-03-26, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sula_
  • Chain 'B':
    Domains in SCOP 1.69: d1sulb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sulA (A:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
    tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
    nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
    gkdeawgaikkminr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sulA (A:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlaqtlnfyiind
    elhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhapsnddvqmyef
    lkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdeawgai
    kkminr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sulB (B:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
    tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
    nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
    gkdeawgaikkminr