PDB entry 1suh

View 1suh on RCSB PDB site
Description: amino-terminal domain of epithelial cadherin in the calcium bound state, nmr, 20 structures
Class: cell adhesion
Keywords: cadherin, calcium binding, cell adhesion
Deposited on 1996-01-30, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epithelial cadherin
    Species: Mus musculus [TaxId:10090]
    Gene: X06115 (GENBANK)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1suha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1suhA (A:)
mrdwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretg
wlkvtqpldreaiakyilyshavssngeavedpmeivitvtdqndnrpeftqevfegsva
egavpgtsvmkvsatdadddvntyna

    Sequence, based on observed residues (ATOM records): (download) 
    >1suhA (A:)
dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndn