PDB entry 1su5

View 1su5 on RCSB PDB site
Description: Understanding protein lids: Structural analysis of active hinge mutants in triosephosphate isomerase
Class: isomerase
Keywords: archae, evolution, flexible loop-6, TIM, N-hinge, ISOMERASE
Deposited on 2004-03-26, released 2004-08-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.187
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene: TPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (0-246)
      • engineered (172-174)
    Domains in SCOPe 2.01: d1su5a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene: TPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (0-246)
      • engineered (172-174)
    Domains in SCOPe 2.01: d1su5b_
  • Heterogens: PGA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1su5A (A:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnpntpqqa
    qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1su5B (B:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnpntpqqa
    qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh