PDB entry 1su3

View 1su3 on RCSB PDB site
Description: X-ray structure of human proMMP-1: New insights into collagenase action
Class: hydrolase
Keywords: Prodomain, Hemopexin domain, exocite, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2004-03-26, released 2004-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-12, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interstitial collagenase
    Species: HOMO SAPIENS
    Gene: MMP1, CLG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1su3a1, d1su3a2, d1su3a3
  • Chain 'B':
    Compound: interstitial collagenase
    Species: HOMO SAPIENS
    Gene: MMP1, CLG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1su3b1, d1su3b2, d1su3b3
  • Heterogens: CA, CL, NA, ZN, SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1su3A (A:)
    fpatletqeqdvdlvqkylekyynlkndgrqvekrrnsgpvveklkqmqeffglkvtgkp
    daetlkvmkqprcgvpdvaqfvltegnprweqthltyrienytpdlpradvdhaiekafq
    lwsnvtpltftkvsegqadimisfvrgdhrdnspfdgpggnlahafqpgpgiggdahfde
    derwtnnfreynlhrvaahelghslglshstdigalmypsytfsgdvqlaqddidgiqai
    ygrsqnpvqpigpqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisv
    fwpqlpngleaayefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhida
    alseentgktyffvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyff
    hgtrqykfdpktkriltlqkanswfncrkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1su3A (A:)
    dlvqkylekyynlkgpvveklkqmqeffglkvtgkpdaetlkvmkqprcgvpdvaprweq
    thltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrgdhrdn
    spfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslglshstd
    igalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpigpqtpkacdskltfdaittir
    gevmffkdrfymrtnpfypevelnfisvfwpqlpngleaayefadrdevrffkgnkywav
    qgqnvlhgypkdiyssfgfprtvkhidaalseentgktyffvankywrydeykrsmdpgy
    pkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpktkriltlqkanswfnc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1su3B (B:)
    fpatletqeqdvdlvqkylekyynlkndgrqvekrrnsgpvveklkqmqeffglkvtgkp
    daetlkvmkqprcgvpdvaqfvltegnprweqthltyrienytpdlpradvdhaiekafq
    lwsnvtpltftkvsegqadimisfvrgdhrdnspfdgpggnlahafqpgpgiggdahfde
    derwtnnfreynlhrvaahelghslglshstdigalmypsytfsgdvqlaqddidgiqai
    ygrsqnpvqpigpqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisv
    fwpqlpngleaayefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhida
    alseentgktyffvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyff
    hgtrqykfdpktkriltlqkanswfncrkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1su3B (B:)
    vdlvqkylekyynlksgpvveklkqmqeffglkvtgkpdaetlkvmkqprcgvpdvaprw
    eqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrgdhr
    dnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslglshs
    tdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpigpqtpkacdskltfdaitt
    irgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaayefadrdevrffkgnkyw
    avqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyffvankywrydeykrsmdp
    gypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpktkriltlqkanswfn