PDB entry 1su2

View 1su2 on RCSB PDB site
Description: crystal structure of the nudix hydrolase dr1025 in complex with ATP
Class: hydrolase
Keywords: NUDIX FOLD, alpha-beta-alpha sandwich, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2004-03-26, released 2004-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.204
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutT/nudix family protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1su2a_
  • Chain 'B':
    Compound: MutT/nudix family protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1su2b_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1su2A (A:)
mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
fvsredfaqlyaagqirmyqtklfyadalrekgfpalpv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1su2B (B:)
mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
fvsredfaqlyaagqirmyqtklfyadalrekgfpalpv