PDB entry 1su1

View 1su1 on RCSB PDB site
Description: Structural and biochemical characterization of Yfce, a phosphoesterase from E. coli
Class: structural genomics, unknown function
Keywords: yfce, structural genomics, phosphoesterase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-03-25, released 2004-08-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yfcE
    Species: Escherichia coli [TaxId:562]
    Gene: YFCE, B2300, C2843, Z3562, ECS3184
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67095 (24-207)
      • cloning artifact (80)
    Domains in SCOPe 2.05: d1su1a_
  • Chain 'B':
    Compound: Hypothetical protein yfcE
    Species: Escherichia coli [TaxId:562]
    Gene: YFCE, B2300, C2843, Z3562, ECS3184
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67095 (24-207)
      • cloning artifact (80)
    Domains in SCOPe 2.05: d1su1b_
  • Chain 'C':
    Compound: Hypothetical protein yfcE
    Species: Escherichia coli [TaxId:562]
    Gene: YFCE, B2300, C2843, Z3562, ECS3184
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67095
      • cloning artifact (80)
    Domains in SCOPe 2.05: d1su1c_
  • Chain 'D':
    Compound: Hypothetical protein yfcE
    Species: Escherichia coli [TaxId:562]
    Gene: YFCE, B2300, C2843, Z3562, ECS3184
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67095
      • cloning artifact (80)
    Domains in SCOPe 2.05: d1su1d_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1su1A (A:)
    mhhhhhhssgvdlgtenlyfqsnammklmfasdihgslpatervlelfaqsgaqwlvilg
    dvlnhgprnalpegyapakvverlnevahkviavrgncdsevdqmllhfpitapwqqvll
    ekqrlflthghlfgpenlpalnqndvlvyghthlpvaeqrgeifhfnpgsvsipkggnpa
    sygmldndvlsvialndqsiiaqvainp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1su1A (A:)
    mmklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverl
    nevahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqn
    dvlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqv
    ainp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1su1B (B:)
    mhhhhhhssgvdlgtenlyfqsnammklmfasdihgslpatervlelfaqsgaqwlvilg
    dvlnhgprnalpegyapakvverlnevahkviavrgncdsevdqmllhfpitapwqqvll
    ekqrlflthghlfgpenlpalnqndvlvyghthlpvaeqrgeifhfnpgsvsipkggnpa
    sygmldndvlsvialndqsiiaqvainp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1su1B (B:)
    mmklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverl
    nevahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqn
    dvlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqv
    ainp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1su1C (C:)
    mhhhhhhssgvdlgtenlyfqsnammklmfasdihgslpatervlelfaqsgaqwlvilg
    dvlnhgprnalpegyapakvverlnevahkviavrgncdsevdqmllhfpitapwqqvll
    ekqrlflthghlfgpenlpalnqndvlvyghthlpvaeqrgeifhfnpgsvsipkggnpa
    sygmldndvlsvialndqsiiaqvainp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1su1C (C:)
    mklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverln
    evahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqnd
    vlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqva
    in
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1su1D (D:)
    mhhhhhhssgvdlgtenlyfqsnammklmfasdihgslpatervlelfaqsgaqwlvilg
    dvlnhgprnalpegyapakvverlnevahkviavrgncdsevdqmllhfpitapwqqvll
    ekqrlflthghlfgpenlpalnqndvlvyghthlpvaeqrgeifhfnpgsvsipkggnpa
    sygmldndvlsvialndqsiiaqvainp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1su1D (D:)
    mklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverln
    evahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqnd
    vlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqva
    in