PDB entry 1stz

View 1stz on RCSB PDB site
Description: crystal structure of a hypothetical protein at 2.2 a resolution
Deposited on 2004-03-25, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1stzA (A:)
    mrrlnrknnealkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmk
    kleylgyiyqphtsagriptdkglrfyyeemlkisketseadlavetfksmpladpekvl
    flagnllarltegyvlierpntrdlkilrvmlipvsedylifsiltefgvskvtpiktqe
    rlnweeierqlnfllrgrtvgevlmgkieslkgsgflrliesligetveryldaglenll
    kdetltledirnlleevkdqkfleslvgegitvrigreigrkklekfavfsgkyfkgesp
    igsvylftskvtkydrnhrvfeyilnrlseyftstsrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1stzA (A:)
    klndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyqpht
    sagriptdkglrfyyeemlkisketseadlavetfksmpladpekvlflagnllarlteg
    yvlierpntrdlkilrvmlipvsedylifsiltefgvskvtpiktqerlnweeierqlnf
    llrgrtvgevlmgkieslkgsgflrliesligetveryldaglenllkdetltledirnl
    leevkdqkfleslvgegitvrigreigrkklekfavfsgkyfkgespigsvylftskvtk
    ydrnhrvfeyilnrlseyftsts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1stzB (B:)
    mrrlnrknnealkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmk
    kleylgyiyqphtsagriptdkglrfyyeemlkisketseadlavetfksmpladpekvl
    flagnllarltegyvlierpntrdlkilrvmlipvsedylifsiltefgvskvtpiktqe
    rlnweeierqlnfllrgrtvgevlmgkieslkgsgflrliesligetveryldaglenll
    kdetltledirnlleevkdqkfleslvgegitvrigreigrkklekfavfsgkyfkgesp
    igsvylftskvtkydrnhrvfeyilnrlseyftstsrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1stzB (B:)
    alkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyq
    phtsagriptdkglrfyyeemlkismpladpekvlflagnllarltegyvlierpntrdl
    kilrvmlipvsedylifsiltefgvskvtpiktqerlnweeierqlnfllrgrtvgevlm
    gkieslkgsgflrliesligetveryldaglenllkdetltledirnlleevkdqkfles
    lvgegitvrigreigrkklekfavfsgkyfkgespigsvylftskvtkydrnhrvfeyil
    nrlseyftsts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1stzC (C:)
    mrrlnrknnealkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmk
    kleylgyiyqphtsagriptdkglrfyyeemlkisketseadlavetfksmpladpekvl
    flagnllarltegyvlierpntrdlkilrvmlipvsedylifsiltefgvskvtpiktqe
    rlnweeierqlnfllrgrtvgevlmgkieslkgsgflrliesligetveryldaglenll
    kdetltledirnlleevkdqkfleslvgegitvrigreigrkklekfavfsgkyfkgesp
    igsvylftskvtkydrnhrvfeyilnrlseyftstsrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1stzC (C:)
    alkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyq
    phtsagriptdkglrfyyeemlkismpladpekvlflagnllarltegyvlierpntrdl
    kilrvmlipvsedylifsiltefgvskvtpiktqerlnweeierqlnfllrgrtvgevlm
    gkieslkgsgflrliesligetveryldaglenllkdetltledirnlleevkdqkfles
    lvgegitvrigreigrkklekfavfsgkyfkgespigsvylftskvtkydrnhrvfeyil
    nrlseyftsts