PDB entry 1sty

View 1sty on RCSB PDB site
Description: the alpha aneurism: a structural motif revealed in an insertion mutant of staphylococcal nuclease
Deposited on 1993-02-18, released 1993-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 1.67 Å
R-factor: 0.17
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sty__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sty_ (-)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
    rgkseaqakkeklniws