PDB entry 1stq

View 1stq on RCSB PDB site
Description: Cyrstal Structure of Cytochrome c Peroxidase Mutant: CcPK2M3
Deposited on 2004-03-25, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1stqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1stqA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalsgahtlgkt
    hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgylqlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1stqA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalsgahtlgkthlk
    nsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgylqlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl