PDB entry 1stq

View 1stq on RCSB PDB site
Description: Cyrstal Structure of Cytochrome c Peroxidase Mutant: CcPK2M3
Class: oxidoreductase
Keywords: CcP, Heme Peroxidase, Cytochrome c Peroxidase, Haem Peroxidase, OXIDOREDUCTASE
Deposited on 2004-03-25, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-293)
      • engineered (171)
      • engineered (175)
      • engineered (191)
      • engineered (193)
      • engineered (198)
      • engineered (200)
      • engineered (229-230)
    Domains in SCOPe 2.07: d1stqa_
  • Heterogens: K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1stqA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalsgahtlgkt
    hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgylqlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1stqA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalsgahtlgkthlk
    nsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgylqlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl