PDB entry 1stg

View 1stg on RCSB PDB site
Description: two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(II)-nucleotide complexes
Class: hydrolase(phosphoric diester)
Keywords: hydrolase(phosphoric diester)
Deposited on 1994-10-27, released 1995-01-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1stga_
  • Heterogens: CO, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1stgA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1stgA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
    rkseaqakkeklniws