PDB entry 1stb

View 1stb on RCSB PDB site
Description: accommodation of insertion mutations on the surface and in the interior of staphylococcal nuclease
Deposited on 1994-01-17, released 1994-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1stb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1stb_ (-)
  klhkepatlikaidgdtvklmykgqpmtfrllllvdtpetkhpkkgvekygpeasaftkk
  mvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqh
  lrkseaqakkeklniws