PDB entry 1sta

View 1sta on RCSB PDB site
Description: accommodation of insertion mutations on the surface and in the interior of staphylococcal nuclease
Deposited on 1994-01-17, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sta__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sta_ (-)
    lhkepggatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkk
    mvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqh
    lrkseaqakkeklniws