PDB entry 1st3

View 1st3 on RCSB PDB site
Description: the crystal structure of the bacillus lentus alkaline protease, subtilisin bl, at 1.4 angstroms resolution
Class: serine protease
Keywords: serine protease
Deposited on 1991-11-22, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin bl
    Species: Bacillus lentus [TaxId:1467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1st3a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1st3A (A:)
    gqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
    ghgthvagtiaalnnsigvlgvapsaelyavkvlgadgrgaissiaqglewagnngmhva
    nlslgspspsatleqavnsatsrgvlvvaasgnsgassisyparyanamavgatdqnnnr
    asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
    rnhlkntatslgstnlygsglvnaeaatr