PDB entry 1st0

View 1st0 on RCSB PDB site
Description: Structure of DcpS bound to m7GpppG
Class: RNA binding protein
Keywords: RNA decay, exosome, decapping, hit protein, messenger RNA, mRNA, cap, RNA binding protein
Deposited on 2004-03-24, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA decapping enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: DCPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C86 (Start-336)
      • engineered (276)
    Domains in SCOPe 2.07: d1st0a1, d1st0a2
  • Chain 'B':
    Compound: mRNA decapping enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: DCPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C86
      • engineered (276)
    Domains in SCOPe 2.07: d1st0b1, d1st0b2
  • Heterogens: YT3, GTG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1st0A (A:)
    madaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlresardk
    iiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiystyhlfp
    prqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqwvynil
    dkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirslrdltpehlpl
    lrnilhqgqeailqryrmkgdhlrvylhylpsyyhlnvhftalgfeapgsgverahllae
    vienlecdprhyqqrtltfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1st0A (A:)
    apvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaql
    ltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgdd
    yrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddly
    liaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhln
    vhftalgfeapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1st0B (B:)
    madaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlresardk
    iiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiystyhlfp
    prqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqwvynil
    dkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirslrdltpehlpl
    lrnilhqgqeailqryrmkgdhlrvylhylpsyyhlnvhftalgfeapgsgverahllae
    vienlecdprhyqqrtltfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1st0B (B:)
    vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt
    gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyr
    nitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyli
    aichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlnvh
    ftalgfeapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq