PDB entry 1ssz

View 1ssz on RCSB PDB site
Description: Conformational mapping of mini-b: an n-terminal/c-terminal construct of surfactant protein b using 13c-enhanced fourier transform infrared (FTIR) spectroscopy
Class: surface active protein
Keywords: lung surfactant protein, saposin
Deposited on 2004-03-24, released 2004-06-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-06, with a file datestamp of 2007-06-28.
Experiment type: FTIR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pulmonary surfactant-associated protein B
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07988 (0-33)
  Domains in SCOP 1.73: d1ssza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sszA (A:)
  cwlcralikriqamipkggrmlpqlvcrlvlrcs