PDB entry 1ssz

View 1ssz on RCSB PDB site
Description: Conformational Mapping of Mini-B: An N-terminal/C-terminal Construct of Surfactant Protein B Using 13C-Enhanced Fourier Transform Infrared (FTIR) Spectroscopy
Class: surface active protein
Keywords: lung surfactant protein, saposin, surface active protein
Deposited on 2004-03-24, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: FTIR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pulmonary surfactant-associated protein B
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07988 (0-33)
  Domains in SCOPe 2.08: d1ssza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sszA (A:)
  cwlcralikriqamipkggrmlpqlvcrlvlrcs