PDB entry 1ssy

View 1ssy on RCSB PDB site
Description: Crystal structure of phage T4 lysozyme mutant G28A/I29A/G30A/C54T/C97A
Class: hydrolase
Keywords: Hydrolase, Glycosidase, Bacteriolytic enzyme
Deposited on 2004-03-24, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (27-29)
      • engineered (53)
      • engineered (96)
    Domains in SCOPe 2.08: d1ssya_
  • Chain 'B':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (27-29)
      • engineered (53)
      • engineered (96)
    Domains in SCOPe 2.08: d1ssyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ssyA (A:)
    mnifemlrideglrlkiykdtegyytiaaahlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ssyB (B:)
    mnifemlrideglrlkiykdtegyytiaaahlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl