PDB entry 1ssu

View 1ssu on RCSB PDB site
Description: Structural and biochemical evidence for disulfide bond heterogeneity in active forms of the somatomedin B domain of human vitronectin
Class: cell adhesion
Keywords: somatostatin B domain, vitronectin, NMR structure, disulfide bonds heterogeneity, CELL ADHESION
Deposited on 2004-03-24, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: VTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ssua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ssuA (A:)
dqesckgrctegfnvdkkcqcdelcsyyqscctdytaeckpqvtrgdvftm