PDB entry 1sst

View 1sst on RCSB PDB site
Description: Serine Acetyltransferase- Complex with CoA
Class: transferase
Keywords: LEFT-HANDED PARALLEL BETA HELIX, transferase
Deposited on 2004-03-24, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ssta_
  • Chain 'B':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sstb_
  • Chain 'C':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sstc_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sstA (A:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sqdkaakpafdmnqyfigiddgmnlni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sstA (A:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    thpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sstB (B:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sqdkaakpafdmnqyfigiddgmnlni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sstB (B:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sstC (C:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sqdkaakpafdmnqyfigiddgmnlni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sstC (C:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv