PDB entry 1sss

View 1sss on RCSB PDB site
Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosin in the active site.
Class: oxidoreductase
Keywords: oxidoreductase, superoxide dismutase, sod, superoxide radical disproportionation, sulfolobus solfataricus, thermostable
Deposited on 1998-11-19, released 1999-04-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2004-11-16, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.166
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sssa3, d1sssa4
  • Chain 'B':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sssb3, d1sssb4
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sssA (A:)
    iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
    qydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfkqvf
    tetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqyknk
    radyvnawwnvvnwdaaekklqkyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sssB (B:)
    iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
    qydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfkqvf
    tetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqyknk
    radyvnawwnvvnwdaaekklqkyl