PDB entry 1ssq

View 1ssq on RCSB PDB site
Description: Serine Acetyltransferase- Complex with Cysteine
Deposited on 2004-03-24, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ssqa_
  • Chain 'D':
    Domains in SCOP 1.69: d1ssqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ssqA (A:)
    mnldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sqdkaakpafdmnqyfigiddgmnlni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssqA (A:)
    mnldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ssqD (D:)
    mnldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sqdkaakpafdmnqyfigiddgmnlni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssqD (D:)
    mnldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sqdkaakpafdmnqyfi