PDB entry 1ssp

View 1ssp on RCSB PDB site
Description: wild-type uracil-DNA glycosylase bound to uracil-containing DNA
Class: hydrolase/DNA
Keywords: DNA glycosylase, DNA base excision repair, uracil, DNA, protein/DNA, hydrolase/DNA complex
Deposited on 1999-04-28, released 1999-05-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*cp*tp*gp*tp*(d1p)p*ap*tp*cp*tp*t)-3'
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*gp*ap*tp*ap*ap*cp*ap*g)-3'
  • Chain 'E':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1sspe_
  • Heterogens: URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sspE (E:)
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel