PDB entry 1ssp

View 1ssp on RCSB PDB site
Description: wild-type uracil-dna glycosylase bound to uracil-containing dna
Deposited on 1999-04-28, released 1999-05-06
The last revision prior to the SCOP 1.63 freeze date was dated 1999-05-06, with a file datestamp of 1999-05-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.63: d1sspe_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sspE (E:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel