PDB entry 1sso

View 1sso on RCSB PDB site
Description: solution structure and DNA-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1995-03-31, released 1995-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 1995-05-08, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sso7d
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ssoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ssoA (A:)
    atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qk