PDB entry 1sso

View 1sso on RCSB PDB site
Description: solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Deposited on 1995-03-31, released 1995-05-08
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-08, with a file datestamp of 1995-05-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sso__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sso_ (-)
    atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qk