PDB entry 1ssm

View 1ssm on RCSB PDB site
Description: Serine Acetyltransferase- Apoenzyme (truncated)
Deposited on 2004-03-24, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ssma_
  • Chain 'B':
    Domains in SCOP 1.69: d1ssmb_
  • Chain 'C':
    Domains in SCOP 1.69: d1ssmc_
  • Chain 'D':
    Domains in SCOP 1.69: d1ssmd_
  • Chain 'E':
    Domains in SCOP 1.69: d1ssme_
  • Chain 'F':
    Domains in SCOP 1.69: d1ssmf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ssmA (A:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmA (A:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ssmB (B:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmB (B:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ssmC (C:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmC (C:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ssmD (D:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmD (D:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ssmE (E:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmE (E:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ssmF (F:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmF (F:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv