PDB entry 1ssm

View 1ssm on RCSB PDB site
Description: Serine Acetyltransferase- Apoenzyme (truncated)
Class: transferase
Keywords: LEFT-HANDED PARALLEL BETA HELIX, transferase
Deposited on 2004-03-24, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (0-End)
      • modified residue (0)
      • modified residue (21)
      • modified residue (53)
      • modified residue (150)
      • modified residue (196)
    Domains in SCOPe 2.08: d1ssma_
  • Chain 'B':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (0-End)
      • modified residue (0)
      • modified residue (21)
      • modified residue (53)
      • modified residue (150)
      • modified residue (196)
    Domains in SCOPe 2.08: d1ssmb_
  • Chain 'C':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (0-End)
      • modified residue (0)
      • modified residue (21)
      • modified residue (53)
      • modified residue (150)
      • modified residue (196)
    Domains in SCOPe 2.08: d1ssmc_
  • Chain 'D':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (0-End)
      • modified residue (0)
      • modified residue (21)
      • modified residue (53)
      • modified residue (150)
      • modified residue (196)
    Domains in SCOPe 2.08: d1ssmd_
  • Chain 'E':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (0-End)
      • modified residue (0)
      • modified residue (21)
      • modified residue (53)
      • modified residue (150)
      • modified residue (196)
    Domains in SCOPe 2.08: d1ssme_
  • Chain 'F':
    Compound: Serine acetyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: CYSE, HI0606
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43886 (0-End)
      • modified residue (0)
      • modified residue (21)
      • modified residue (53)
      • modified residue (150)
      • modified residue (196)
    Domains in SCOPe 2.08: d1ssmf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ssmA (A:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmA (A:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ssmB (B:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmB (B:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ssmC (C:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmC (C:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ssmD (D:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmD (D:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ssmE (E:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmE (E:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ssmF (F:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssmF (F:)
    mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
    eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
    rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
    tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv