PDB entry 1ssk

View 1ssk on RCSB PDB site
Description: Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein
Class: structural protein
Keywords: nucleocapsid protein, STRUCTURAL PROTEIN
Deposited on 2004-03-24, released 2004-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: SARS coronavirus [TaxId:227859]
    Gene: N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59595 (21-157)
      • cloning artifact (0-3)
      • expression tag (4-9)
      • cloning artifact (10-19)
      • initiating methionine (20)
    Domains in SCOPe 2.06: d1sska1, d1sska2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sskA (A:)
mgsshhhhhhssglvprgsamglpnntaswftaltqhgkeelrfprgqgvpintnsgpdd
qigyyrratrrvrggdgkmkelsprwyfyylgtgpeaslpygankegivwvategalntp
kdhigtrnpnnnaatvlqlpqgttlpkgfyaegsrggs