PDB entry 1ssh

View 1ssh on RCSB PDB site
Description: Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein in complex with a peptide
Class: contractile protein
Keywords: SH3 domain, yeast, structural genomics, protein-peptide complex, CONTRACTILE PROTEIN
Deposited on 2004-03-24, released 2005-04-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43603 (1-59)
      • cloning artifact (0)
    Domains in SCOPe 2.02: d1ssha_
  • Chain 'B':
    Compound: 12-mer peptide from Cytoskeleton assembly control protein SLA1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sshA (A:)
gsspkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv

  • Chain 'B':
    No sequence available.