PDB entry 1ssf

View 1ssf on RCSB PDB site
Description: Solution structure of the mouse 53BP1 fragment (residues 1463-1617)
Class: cell cycle
Keywords: Tudor domains, tandem, SH3-like fold, Beta barrel, alpha-helix
Deposited on 2004-03-24, released 2004-09-14
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-14, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transformation related protein 53 binding protein 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ssfa1, d1ssfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ssfA (A:)
    gdssssgnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcd
    pipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrl
    reqyglgpyeavtpltkaadisldnlvegkrkrrsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ssfA (A:)
    nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldte
    vtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyglg
    pye