PDB entry 1sse

View 1sse on RCSB PDB site
Description: Solution structure of the oxidized form of the Yap1 redox domain
Class: transcription activator
Keywords: disulfide bond, nuclear export signal, NES, redox-regulation, TRANSCRIPTION ACTIVATOR
Deposited on 2004-03-24, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AP-1 like transcription factor YAP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YAP1, SNQ3, PAR1, PDR4, YML007W, YM9571.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sse.1
  • Chain 'B':
    Compound: AP-1 like transcription factor YAP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YAP1, SNQ3, PAR1, PDR4, YML007W, YM9571.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sse.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sseA (A:)
nldsnmfsndfnfenqfdeqvsefcskmnqvcgtr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sseB (B:)
ngsslqnadkinngndndndndvvpskegsllrcseiwdritthpkysdidvdglcselm
akakcsergvvinaedvqlalnkhmn