PDB entry 1ssc

View 1ssc on RCSB PDB site
Description: the 1.6 angstroms structure of a semisynthetic ribonuclease crystallized from aqueous ethanol. comparison with crystals from salt solutions and with RNAse a from aqueous alcohol solutions
Class: endonuclease
Keywords: endonuclease
Deposited on 1994-10-05, released 1995-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.166
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-111)
  Domains in SCOPe 2.07: d1ssc.1
• Chain 'B':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-10)
  Domains in SCOPe 2.07: d1ssc.1
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sscA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivaceg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sscB (B:)
  pyvpvhfdasv