PDB entry 1ss9

View 1ss9 on RCSB PDB site
Description: Crystal Structural Analysis of Active Site Mutant Q189E of LgtC
Class: transferase
Keywords: alpha-beta protein, transferase
Deposited on 2004-03-23, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1,4-galactosyl transferase
    Species: Neisseria meningitidis [TaxId:487]
    Gene: LGTC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93EK7 (0-End)
      • engineered (188)
    Domains in SCOPe 2.08: d1ss9a_
  • Heterogens: MN, UPF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ss9A (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgacidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmscewveqy
    kdvmqyqdedilnglfkggvcyansrfnfmptnyafmanrfasrhtdplyrdrtntvmpv
    avshycgpakpwhrdctawgaerftelagslttvpeewrgklavphrmfstkrmlqrwrr
    klsarflrkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ss9A (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgacidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmscewveqy
    kdvmqyqdedilnglfkggvcyansrfnfmptnyafmanasrhtdplyrdrtntvmpvav
    shycgpakpwhrdctawgaerftelagslttvpeewrgkl