PDB entry 1ss4

View 1ss4 on RCSB PDB site
Description: Crystal Structure of the Glyoxalase Family Protein APC24694 from Bacillus cereus
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, Glyoxalase, Bacillus cereus, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-03-23, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.202
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyoxalase family protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81F54 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (11)
      • modified residue (61-62)
      • modified residue (99)
      • modified residue (108)
    Domains in SCOPe 2.08: d1ss4a1, d1ss4a2
  • Chain 'B':
    Compound: Glyoxalase family protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81F54
      • modified residue (11)
      • modified residue (61-62)
      • modified residue (99)
      • modified residue (108)
    Domains in SCOPe 2.08: d1ss4b_
  • Heterogens: ACT, NA, MG, CIT, GSH, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ss4A (A:)
    snamaknkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcvei
    ammvtpdghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgael
    vgevvqyensyrlcyirgvegiliglaeelgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ss4A (A:)
    amaknkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcveiam
    mvtpdghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgaelvg
    evvqyensyrlcyirgvegiliglaeelg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ss4B (B:)
    snamaknkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcvei
    ammvtpdghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgael
    vgevvqyensyrlcyirgvegiliglaeelgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ss4B (B:)
    nkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcveiammvtp
    dghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgaelvgevvq
    yensyrlcyirgvegiliglaeelg