PDB entry 1ss3

View 1ss3 on RCSB PDB site
Description: Solution structure of Ole e 6, an allergen from olive tree pollen
Class: allergen
Keywords: alpha-helix protein, ALLERGEN
Deposited on 2004-03-23, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pollen allergen Ole e 6
    Species: Olea europaea [TaxId:4146]
    Gene: OLE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ss3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ss3A (A:)
deaqfkecydtchkecsdkgngftfcemkcdtdcsvkdvkeklenykpkn