PDB entry 1ss2

View 1ss2 on RCSB PDB site
Description: Solution structure of the second complement control protein (CCP) module of the GABA(B)R1a receptor, Pro-119 cis conformer
Class: signaling protein
Keywords: GABA(B) receptor, cis-trans isomerisation, CCP module, sushi domain, short consensus repeat, SIGNALING PROTEIN
Deposited on 2004-03-23, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid type B receptor, subunit 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GABBR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z0U4 (4-67)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d1ss2a1, d1ss2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ss2A (A:)
    eaefvricsksyltlengkvfltggdlpaldgarvefrcdpdfhlvgssrsvcsqgqwst
    pkphcqvn