PDB entry 1srx

View 1srx on RCSB PDB site
Description: three-dimensional structure of escherichia coli thioredoxin-s2 to 2.8 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1976-05-06, released 1976-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Escherichia coli [TaxId:37762]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • conflict (15-16)
      • conflict (70-71)
    Domains in SCOPe 2.08: d1srxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srxA (A:)
    sdkiihltddsfdtdlvkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkyiergiptlllfkngevaatkvgalskgqlkefldanla