PDB entry 1srv

View 1srv on RCSB PDB site
Description: thermus thermophilus groel (hsp60 class) fragment (apical domain) comprising residues 192-336
Deposited on 1999-03-02, released 1999-03-12
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1srva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1srvA (A:)
  gyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkplliia
  edvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfklen
  atlsmlgraervritkdettivggk