PDB entry 1sru

View 1sru on RCSB PDB site
Description: Crystal structure of full length E. coli SSB protein
Class: replication
Keywords: replication
Deposited on 2004-03-23, released 2004-08-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.288
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Escherichia coli
    Gene: SSB, EXRB, LEXC, B4059, C5049, Z5658, ECS5041, SF4145, S3584
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1srua_
  • Chain 'B':
    Compound: Single-strand binding protein
    Species: Escherichia coli
    Gene: SSB, EXRB, LEXC, B4059, C5049, Z5658, ECS5041, SF4145, S3584
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1srub_
  • Chain 'C':
    Compound: Single-strand binding protein
    Species: Escherichia coli
    Gene: SSB, EXRB, LEXC, B4059, C5049, Z5658, ECS5041, SF4145, S3584
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1sruc_
  • Chain 'D':
    Compound: Single-strand binding protein
    Species: Escherichia coli
    Gene: SSB, EXRB, LEXC, B4059, C5049, Z5658, ECS5041, SF4145, S3584
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1srud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sruA (A:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sruA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatsesweqtewhrvvlfgklaevase
    ylrkgsqvyiegqlrtrkwtdqdryttevvvnvggtmqml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sruB (B:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sruB (B:)
    asrgvnkvilvgnlgqdpevravanitlatsesweqtewhrvvlfgklaevaseylrkgs
    qvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sruC (C:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sruC (C:)
    asrgvnkvilvgnlgqdpevryavanitlatsesweqtewhrvvlfgklaevaseylrkg
    sqvyiegqlrtrkwtdqsdryttevvvnvggtmqml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sruD (D:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sruD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatsesweqtewhrvvlfgklaevase
    ylrkgsqvyiegqlrtrkwtdqsdryttevvvnvggtmqml