PDB entry 1srr

View 1srr on RCSB PDB site
Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis
Class: regulatory protein
Keywords: aspartate pocket, sporulation response regulator, two component system, regulatory protein
Deposited on 1996-04-10, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sporulation response regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • conflict (12)
    Domains in SCOPe 2.07: d1srra_
  • Chain 'B':
    Compound: sporulation response regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • conflict (12)
    Domains in SCOPe 2.07: d1srrb_
  • Chain 'C':
    Compound: sporulation response regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • conflict (12)
    Domains in SCOPe 2.07: d1srrc_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1srrA (A:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1srrA (A:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1srrB (B:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1srrB (B:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1srrC (C:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1srrC (C:)
    mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
    gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    k