PDB entry 1sro

View 1sro on RCSB PDB site
Description: s1 RNA binding domain, nmr, 20 structures
Class: s1 RNA-binding domain
Keywords: s1 RNA-binding domain, polynucleotide phosphorylase (pnpase)
Deposited on 1996-11-27, released 1997-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pnpase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sroa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sroA (A:)
    aeievgrvytgkvtrivdfgafvaigggkeglvhisqiadkrvekvtdylqmgqevpvkv
    levdrqgrirlsikea