PDB entry 1sra

View 1sra on RCSB PDB site
Description: structure of a novel extracellular ca2+-binding module in bm-40(slash)sparc(slash)osteonectin
Class: calcium-binding protein
Keywords: extracellular matrix protein
Deposited on 1995-08-21, released 1996-03-08
The last revision prior to the SCOP 1.73 freeze date was dated 1996-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sparc
    Species: HOMO SAPIENS
    Gene: HUMAN BM-40
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sraa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sraA (A:)
    ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
    vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
    cdldndkyialdewagcfgikqkdidkdlvi