PDB entry 1sra

View 1sra on RCSB PDB site
Description: structure of a novel extracellular ca2+-binding module in bm-40(slash)sparc(slash)osteonectin
Deposited on 1995-08-21, released 1996-03-08
The last revision prior to the SCOP 1.71 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1sra__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sra_ (-)
    ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
    vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
    cdldndkyialdewagcfgikqkdidkdlvi