PDB entry 1sr7

View 1sr7 on RCSB PDB site
Description: Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate
Class: transcription
Keywords: progesterone receptor, mometasone, progesterone, nuclear receptor, hormone receptor, TRANSCRIPTION
Deposited on 2004-03-22, released 2004-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.176
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR, NR3C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sr7a_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR, NR3C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sr7b_
  • Heterogens: SO4, MOF, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sr7A (A:)
    gspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsk
    slpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessf
    yslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelik
    aiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevia
    aqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr7A (A:)
    qlipplinllmsiepdviyaghdnpdtssslltslnqlgerqllsvvkwskslpgfrnlh
    iddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmwq
    ipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkgv
    vsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilag
    mvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sr7B (B:)
    gspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsk
    slpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessf
    yslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelik
    aiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevia
    aqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr7B (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfh