PDB entry 1sr6

View 1sr6 on RCSB PDB site
Description: Structure of nucleotide-free scallop myosin S1
Class: contractile protein
Keywords: scallop myosin S1, near rigor, complex salt bridge, novel conformation of nucleotide
Deposited on 2004-03-22, released 2004-06-15
The last revision prior to the SCOP 1.75 freeze date was dated 2004-06-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.242
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain, striated muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1sr6a1, d1sr6a2
  • Chain 'B':
    Compound: myosin regulatory light chain, striated adductor muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1sr6b_
  • Chain 'C':
    Compound: myosin essential light chain, striated adductor muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1sr6c_
  • Heterogens: SO4, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sr6A (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkpllsia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr6A (A:)
    sdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivadss
    trtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnp
    yrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkten
    tkkvimylakvacavgsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptgki
    agadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgcl
    tvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkqrpreeqaesdgt
    aeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvgalakslydrmfnw
    lvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileq
    eeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmg
    knrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskepl
    vaelfkapeqtisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqc
    ngvlegiricrkgfpsrliysefkqrysilapnaipqdgktvsekilaglqmdpaeyrlg
    ttkvffkagvlgnleemrderlskiismfqahirgylirkaykklqdqriglsviqrnir
    kwlvlrnwqwwklyskvkpll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sr6B (B:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr6B (B:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikgsgeeea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sr6C (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr6C (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypd