PDB entry 1sr4

View 1sr4 on RCSB PDB site
Description: Crystal Structure of the Haemophilus ducreyi cytolethal distending toxin
Class: toxin
Keywords: toxin, bacterial, Haemophilus ducreyi, virulence, DNA Damage, genotoxin, cytotoxins, Cell Cycle, Apoptosis, lectin, Deoxyribonuclease I
Deposited on 2004-03-22, released 2004-06-15
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytolethal distending toxin subunit A
    Species: Haemophilus ducreyi
    Gene: CDTA, HD0902
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sr4a_
  • Chain 'B':
    Compound: cytolethal distending toxin protein B
    Species: Haemophilus ducreyi
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sr4b_
  • Chain 'C':
    Compound: cytolethal distending toxin protein C
    Species: Haemophilus ducreyi
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sr4c_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sr4A (A:)
    snqrmndysqpesqsdlapksstiqpqpqpllsktpsmslnllsssgpnrqvlpsepsnf
    mtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkmepgkhreyfrfvnqslgtc
    veaygnglihdicsldklaqefellptdsgavviksvsqgrcvtynpvsttfystvtlsv
    cdgatepsrdqtwylappvleatavn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr4A (A:)
    lnllsssgpnrqvlpsepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnw
    kmepgkhreyfrfvnqslgtcveaygnglihdicsldklaqefellptdsgavviksvsq
    grcvtynpvsttfystvtlsvcdgatepsrdqtwylappvleatavn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sr4B (B:)
    nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
    hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
    srpavgirigtdvfftvhalatggsdavslirnifttfnsssspperrvyswmvvgdfnr
    apanlevalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslm
    lnqlrsqitsdhfpvsfvrdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr4B (B:)
    nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
    hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
    srpavgirigtdvfftvhalatggsdavslirnifttfnspperrvyswmvvgdfnrapa
    nlevalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslmlnq
    lrsqitsdhfpvsfvrdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sr4C (C:)
    esnpdpttypdvelsppprislrslltaqpvkndhydshnylsthwelidykgkeyeklr
    dggtlvqfkvvgaakcfaflgkgttdckdtdhtvfnliptntgaflikdallgfcitshd
    fddlklepcggsvsgrtfslayqwgilppfgpskilippvrrnqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr4C (C:)
    dpttypdvelsppprislrslltaqpvkndhydshnylsthwelidykgkeyeklrdggt
    lvqfkvvgaakcfaflgkgttdckdtdhtvfnliptntgaflikdallgfcitshdfddl
    klepcggsvsgrtfslayqwgilppfgpskilip