PDB entry 1sr2

View 1sr2 on RCSB PDB site
Description: solution structure of the escherichia coli yojn histidine- phosphotransferase (hpt) domain
Deposited on 2004-03-22, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1sr2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sr2A (A:)
  mqeavlqlievqlaqeevtesplggdenaqlhasgyyalfvdtvpddvkrlyteaatsdf
  aalaqtahrlkgvfamlnlvpgkqlcetlehlirekdvpgiekyisdidsyvksll