PDB entry 1sr2

View 1sr2 on RCSB PDB site
Description: Solution structure of the Escherichia coli YojN Histidine-Phosphotransferase (HPt) domain
Class: transferase
Keywords: Four-helical bundle, transferase
Deposited on 2004-03-22, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative sensor-like histidine kinase yojN
    Species: Escherichia coli [TaxId:562]
    Gene: YOJN, B2216
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sr2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sr2A (A:)
    mqeavlqlievqlaqeevtesplggdenaqlhasgyyalfvdtvpddvkrlyteaatsdf
    aalaqtahrlkgvfamlnlvpgkqlcetlehlirekdvpgiekyisdidsyvksll