PDB entry 1sqs

View 1sqs on RCSB PDB site
Description: X-Ray Crystal Structure Protein SP1951 of Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR27.
Class: structural genomics, unknown function
Keywords: structural genomics, alpha beta protein, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-03-19, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP1951
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97NR6 (0-End)
      • modified residue (0)
      • modified residue (143)
      • modified residue (166)
      • modified residue (210)
    Domains in SCOPe 2.07: d1sqsa_
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP1951
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97NR6 (0-End)
      • modified residue (0)
      • modified residue (143)
      • modified residue (166)
      • modified residue (210)
    Domains in SCOPe 2.07: d1sqsb_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqsA (A:)
    mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
    idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
    tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
    ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyveniklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqsA (A:)
    mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
    idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
    tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
    ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyven
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqsB (B:)
    mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
    idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
    tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
    ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyveniklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqsB (B:)
    mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
    idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
    tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
    ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyven